PDB entry 2isq

View 2isq on RCSB PDB site
Description: Crystal Structure of O-Acetylserine Sulfhydrylase from Arabidopsis Thaliana in Complex with C-Terminal Peptide from Arabidopsis Serine Acetyltransferase
Class: transferase
Keywords: alpha beta structrual domain, TRANSFERASE
Deposited on 2006-10-18, released 2007-02-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.188
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine synthase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: OASA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2isqa_
  • Chain 'B':
    Compound: Serine acetyltransferase 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: SAT1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2isqA (A:)
sriakdvteligntplvylnnvaegcvgrvaaklemmepcssvkdrigfsmisdaekkgl
ikpgesvlieptsgntgvglaftaaakgykliitmpasmsterriillafgvelvltdpa
kgmkgaiakaeeilaktpngymlqqfenpanpkihyettgpeiwkgtggkidgfvsgigt
ggtitgagkylkeqnanvklygvepvesailsggkpgphkiqgigagfipsvlnvdlide
vvqvssdesidmarqlalkegllvgissgaaaaaaiklaqrpenagklfvaifpsfgery
lstvlfdatrkeaeamtfea

  • Chain 'B':
    No sequence available.