PDB entry 2iq9

View 2iq9 on RCSB PDB site
Description: PFA2 FAB fragment, triclinic apo form
Class: immune system
Keywords: pfa2, wwddd, cdr, IMMUNE SYSTEM
Deposited on 2006-10-13, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.215
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: IgG2a Fab fragment PFA2 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IQ9 (0-222)
  • Chain 'L':
    Compound: IgG2a Fab fragment PFA2 Kappa light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IQ9 (0-218)
    Domains in SCOPe 2.07: d2iq9l1, d2iq9l2
  • Heterogens: ACM, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iq9L (L:)
    dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec