PDB entry 2iq6

View 2iq6 on RCSB PDB site
Description: Crystal Structure of the Aminopeptidase from Vibrio proteolyticus in Complexation with Leucyl-leucyl-leucine.
Class: hydrolase
Keywords: aminopeptidase, hydrolase, metalloprotein, metallohydrolase, peptidase, metalloproteinase, zinc, protease, exopeptidase
Deposited on 2006-10-13, released 2007-08-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacterial leucyl aminopeptidase
    Species: Vibrio proteolyticus [TaxId:671]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2iq6a_
  • Chain 'B':
    Compound: Peptide, (Leucyl-leucyl-leucine)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2IQ6 (0-2)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iq6A (A:)
    mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
    pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
    giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
    tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
    ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg
    

  • Chain 'B':
    No sequence available.