PDB entry 2ip4

View 2ip4 on RCSB PDB site
Description: Crystal Structure of Glycinamide Ribonucleotide Synthetase from Thermus thermophilus HB8
Class: ligase
Keywords: GAR synthetase, PurD, thermus thermophilus, purine nucleotide, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2006-10-11, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.218
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylamine--glycine ligase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0811
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ip4a1, d2ip4a2, d2ip4a3
  • Chain 'B':
    Compound: Phosphoribosylamine--glycine ligase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0811
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ip4b1, d2ip4b2, d2ip4b3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ip4A (A:)
    mkvlvvgsggrehallwkaaqsprvkrlyaapgnagmealaelvpwngdvealadwalae
    gidltlvgpeaplvegiadafqarglllfgptqkaamiegskafakglmerygiptaryr
    vfreplealayleevgvpvvvkdsglaagkgvtvafdlhqakqavanilnraeggevvve
    eylegeeatvlaltdgetilpllpsqdhkrlldgdqgpmtggmgavapypmdeatlrrve
    eeilgplvrglraegvvyrgvvyaglmltregpkvlefnarfgdpeaqallpllendlve
    lalrvaegrlagtrlswkegaaacvvlaapgypesprkgiplhvpeppegvlvfhagtrr
    eggrlvsaggrvlnvvglgrdlkealerayayipqvgfpgavyrrdigrralarlst
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ip4A (A:)
    mkvlvvgsggrehallwkaaqsprvkrlyaapgnagmealaelvpwngdvealadwalae
    gidltlvgpeaplvegiadafqarglllfgptqkaamiegskafakglmerygiptaryr
    vfreplealayleevgvpvvvkdsglaagkgvtvafdlhqakqavanilnraeggevvve
    eylegeeatvlaltdgetilpllpsqdhkrlldgdqgpmtggmgavapypmdeatlrrve
    eeilgplvrglraegvvyrgvvyaglmltregpkvlefnarfgdpeaqallpllendlve
    lalrvaegrlagtrlswkegaaacvvlaapgypesprkgiplhvpeppegvlvfhagtrr
    eggrlvsaggrvlnvvglgrdlkealerayayipqvgfpgavyrrdigrralar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ip4B (B:)
    mkvlvvgsggrehallwkaaqsprvkrlyaapgnagmealaelvpwngdvealadwalae
    gidltlvgpeaplvegiadafqarglllfgptqkaamiegskafakglmerygiptaryr
    vfreplealayleevgvpvvvkdsglaagkgvtvafdlhqakqavanilnraeggevvve
    eylegeeatvlaltdgetilpllpsqdhkrlldgdqgpmtggmgavapypmdeatlrrve
    eeilgplvrglraegvvyrgvvyaglmltregpkvlefnarfgdpeaqallpllendlve
    lalrvaegrlagtrlswkegaaacvvlaapgypesprkgiplhvpeppegvlvfhagtrr
    eggrlvsaggrvlnvvglgrdlkealerayayipqvgfpgavyrrdigrralarlst
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ip4B (B:)
    mkvlvvgsggrehallwkaaqsprvkrlyaapgnagmealaelvpwngdvealadwalae
    gidltlvgpeaplvegiadafqarglllfgptqkaamiegskafakglmerygiptaryr
    vfreplealayleevgvpvvvkdsglaagkgvtvafdlhqakqavanilnraeggevvve
    eylegeeatvlaltdgetilpllpsqdhkrlldgdqgpmtggmgavapypmdeatlrrve
    eeilgplvrglraegvvyrgvvyaglmltregpkvlefnarfgdpeaqallpllendlve
    lalrvaegrlagtrlswkegaaacvvlaapgypesprkgiplhvpeppegvlvfhagtrr
    eggrlvsaggrvlnvvglgrdlkealerayayipqvgfpgavyrrdigrralar