PDB entry 2iog

View 2iog on RCSB PDB site
Description: Human estrogen receptor alpha ligand-binding domain in complex with compound 11F
Class: hormone
Keywords: nuclear receptor, transcription factor, er-alpha, antagonist, hormone
Deposited on 2006-10-10, released 2007-10-09
The last revision prior to the SCOP 1.75 freeze date was dated 2007-10-09, with a file datestamp of 2007-10-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.212
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ioga1
  • Heterogens: IOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iogA (A:)
    sltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpgfv
    dltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdml
    latssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlih
    lmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr
    lhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iogA (A:)
    sltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpgfv
    dltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdml
    latssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlih
    lmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr
    lha