PDB entry 2io0

View 2io0 on RCSB PDB site
Description: Crystal structure of human Senp2 in complex with preSUMO-2
Class: protein binding, hydrolase
Keywords: SUMO, Ubiquitin, Senp, Ulp, complex, PROTEIN BINDING, HYDROLASE
Deposited on 2006-10-09, released 2006-11-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sentrin-specific protease 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SENP2, KIAA1331
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HC62 (6-231)
      • engineered (190)
    Domains in SCOPe 2.05: d2io0a1
  • Chain 'B':
    Compound: Small ubiquitin-related modifier 2 precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: SUMO2, SMT3B, SMT3H2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61956 (Start-82)
      • cloning artifact (83-86)
    Domains in SCOPe 2.05: d2io0b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2io0A (A:)
    gshmasdlleltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevin
    fymnllvernkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkv
    hwslvvidlrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkph
    eipqqlngsdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2io0A (A:)
    dlleltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnll
    vernkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvv
    idlrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqql
    ngsdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2io0B (B:)
    mandhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdt
    paqlemededtidvfqqqtggvylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2io0B (B:)
    dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq
    lemededtidvfqqqtggvylehh