PDB entry 2ind

View 2ind on RCSB PDB site
Description: Mn(II) Reconstituted Toluene/o-xylene Monooxygenase Hydroxylase X-ray Crystal Structure
Class: oxidoreductase
Keywords: manganese reconstitution, 4-helix bundle, carboxylate bridge, metalloenzyme, Oxidoreductase
Deposited on 2006-10-06, released 2006-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toluene, o-xylene monooxygenase oxygenase subunit
    Species: Pseudomonas stutzeri [TaxId:316]
    Gene: touA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2inda_
  • Chain 'B':
    Compound: Toluene, o-xylene monooxygenase oxygenase subunit
    Species: Pseudomonas stutzeri [TaxId:316]
    Gene: touE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2indb_
  • Chain 'C':
    Compound: TouB protein
    Species: Pseudomonas stutzeri [TaxId:316]
    Gene: touB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2indc_
  • Heterogens: MN, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2indA (A:)
    smlkredwydltrttnwtpkyvtenelfpeemsgargismeawekydepykitypeyvsi
    qrekdsgaysikaalerdgfvdradpgwvstmqlhfgaialeeyaastaearmarfakap
    gnrnmatfgmmdenrhgqiqlyfpyanvkrsrkwdwahkaihtnewaaiaarsffddmmm
    trdsvavsimltfafetgftnmqflglaadaaeagdhtfaslissiqtdesrhaqqggps
    lkilvengkkdeaqqmvdvaiwrswklfsvltgpimdyytplesrnqsfkefmlewivaq
    ferqlldlgldkpwywdqfmqdldethhgmhlgvwywrptvwwdpaagvspeerewleek
    ypgwndtwgqcwdvitdnlvngkpeltvpetlpticnmcnlpiahtpgnkwnvkdyqley
    egrlyhfgseadrwcfqidperyknhtnlvdrflkgeiqpadlagalmymslepgvmgdd
    ahdyewvkayq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2indB (B:)
    alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
    khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
    arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
    rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
    tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
    pdgenaiveaksasryvrqmmgl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2indC (C:)
    tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf
    prgmivsdaglrptetldiifmd