PDB entry 2imp

View 2imp on RCSB PDB site
Description: Crystal structure of lactaldehyde dehydrogenase from E. coli: the ternary complex with product bound (L)-lactate and NADH.
Class: oxidoreductase
Keywords: protein-lactate-NADH ternary complex, OXIDOREDUCTASE
Deposited on 2006-10-04, released 2007-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lactaldehyde dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25553 (Start-478)
      • modified residue (248)
    Domains in SCOPe 2.07: d2impa_
  • Heterogens: SO4, NAI, LAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2impA (A:)
    msvpvqhpmyidgqfvtwrgdawidvvnpateavisripdgqaedarkaidaaeraqpew
    ealpaieraswlrkisagireraseisaliveeggkiqqlaevevaftadyidymaewar
    ryegeiiqsdrpgenillfkralgvttgilpwnfpffliarkmapalltgntivikpsef
    tpnnaiafakivdeiglprgvfnlvlgrgetvgqelagnpkvamvsmtgsvsagekimat
    aaknitkvclelggkapaivmddadlelavkaivdsrvinsgqvcncaervyvqkgiydq
    fvnrlgeamqavqfgnpaerndiamgplinaaalerveqkvaraveegarvafggkaveg
    kgyyypptllldvrqemsimheetfgpvlpvvafdtledaismandsdygltssiytqnl
    nvamkaikglkfgetyinrenfeamqgfhagwrksgiggadgkhglheylqtqvvylqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2impA (A:)
    vpvqhpmyidgqfvtwrgdawidvvnpateavisripdgqaedarkaidaaeraqpewea
    lpaieraswlrkisagireraseisaliveeggkiqqlaevevaftadyidymaewarry
    egeiiqsdrpgenillfkralgvttgilpwnfpffliarkmapalltgntivikpseftp
    nnaiafakivdeiglprgvfnlvlgrgetvgqelagnpkvamvsmtgsvsagekimataa
    knitkvclelggkapaivmddadlelavkaivdsrvinsgqvcncaervyvqkgiydqfv
    nrlgeamqavqfgnpaerndiamgplinaaalerveqkvaraveegarvafggkavegkg
    yyypptllldvrqemsimheetfgpvlpvvafdtledaismandsdygltssiytqnlnv
    amkaikglkfgetyinrenfeamqgfhagwrksgiggadgkhglheylqtqvvylqs