PDB entry 2imn

View 2imn on RCSB PDB site
Description: Refined crystal structure of a recombinant immunoglobulin domain and a complementarity-determining region 1-grafted mutant
Class: imunoglobulin
Keywords: imunoglobulin
Deposited on 1992-03-30, released 1993-07-15
The last revision prior to the SCOP 1.75 freeze date was dated 1993-07-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.149
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: iga-kappa mcpc603 fv (light chain)
  Species: Mus musculus
  Database cross-references and differences (RAF-indexed):
  • GB AAA72671 (0-112)
    • insertion (30)
    • conflict (30)
    • conflict (30)
  Domains in SCOP 1.75: d2imna_
• Heterogens: SO4, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2imnA (A:)
  divmtqspsslsvsagervtmsckssqsllykdgknflawyqqkpgqppklliygastre
  sgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtklelkr