PDB entry 2imm

View 2imm on RCSB PDB site
Description: Refined crystal structure of a recombinant immunoglobulin domain and a complementarity-determining region 1-grafted mutant
Deposited on 1993-03-01, released 1993-07-15
The last revision prior to the SCOP 1.71 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.149
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d2imm__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2imm_ (-)
    divmtqspsslsvsagervtmsckssqsllnsgnqknflawyqqkpgqppklliygastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndhsypltfgagtklelkr