PDB entry 2imc

View 2imc on RCSB PDB site
Description: Clostridium botulinum Neurotoxin Serotype A Light Chain, Residues 1-424
Class: hydrolase
Keywords: Clostridium botulinum neurotoxin serotype A, protease inhibitors, substrate specificity, HYDROLASE
Deposited on 2006-10-04, released 2007-06-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin A light-chain
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botA, atx, bna
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7B8V4 (20-End)
      • cloning artifact (10-19)
      • conflict (21)
    Domains in SCOPe 2.04: d2imca_
  • Chain 'B':
    Compound: Botulinum neurotoxin A light-chain
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botA, atx, bna
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7B8V4 (20-End)
      • cloning artifact (10-19)
      • conflict (21)
    Domains in SCOPe 2.04: d2imcb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2imcA (A:)
    mgsshhhhhhssglvprgshmqfvnkqfnykdpvngvdiayikipnvgqmqpvkafkihn
    kiwviperdtftnpeegdlnpppeakqvpvsyydstylstdnekdnylkgvtklferiys
    tdlgrmlltsivrgipfwggstidtelkvidtncinviqpdgsyrseelnlviigpsadi
    iqfecksfghevlnltrngygstqyirfspdftfgfeeslevdtnpllgagkfatdpavt
    lahelihaghrlygiainpnrvfkvntnayyemsglevsfeelrtfgghdakfidslqen
    efrlyyynkfkdiastlnkaksivgttaslqymknvfkekyllsedtsgkfsvdklkfdk
    lykmlteiytednfvkffkvlnrktylnfdkavfkinivpkvnytiydgfnlrntnlaan
    fngqnteinnmnftklknftglfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2imcA (A:)
    ssglvprgshmqfvnkqfnykdpvngvdiayikipqmqpvkafkihnkiwviperdtftn
    peegdlnpppeqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgi
    pfwggstidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnl
    trngygstqyirfspdftfgfeeslgagkfatdpavtlahelihaghrlygiainpnrve
    vsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkaksivgttaslqymknvf
    kekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvlnrktylnfdkavfkin
    ivpkvnytiydgfnlrntnlaanfngqnteinnmnftklkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2imcB (B:)
    mgsshhhhhhssglvprgshmqfvnkqfnykdpvngvdiayikipnvgqmqpvkafkihn
    kiwviperdtftnpeegdlnpppeakqvpvsyydstylstdnekdnylkgvtklferiys
    tdlgrmlltsivrgipfwggstidtelkvidtncinviqpdgsyrseelnlviigpsadi
    iqfecksfghevlnltrngygstqyirfspdftfgfeeslevdtnpllgagkfatdpavt
    lahelihaghrlygiainpnrvfkvntnayyemsglevsfeelrtfgghdakfidslqen
    efrlyyynkfkdiastlnkaksivgttaslqymknvfkekyllsedtsgkfsvdklkfdk
    lykmlteiytednfvkffkvlnrktylnfdkavfkinivpkvnytiydgfnlrntnlaan
    fngqnteinnmnftklknftglfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2imcB (B:)
    ssglvprgshmqfvnkqfnykdpvngvdiayikipnvgqmqpvkafkihnkiwviperdt
    ftnpeegdlnpppqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivr
    gipfwggstidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevl
    nltrngygstqyirfspdftfgfeeslevllgagkfatdpavtlahelihaghrlygiai
    npnrvfvsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkaksivgttaslq
    ymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvlnrktylnfdk
    avfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftkl