PDB entry 2ilp

View 2ilp on RCSB PDB site
Description: Clostridium botulinum Serotype A Light Chain inhibited by 4-chlorocinnamic hydroxamate
Class: hydrolase
Keywords: Clostridium botulinum neurotoxin, Type A, substrate specificity, substrate switching, protease inhibitors, HYDROLASE
Deposited on 2006-10-03, released 2007-06-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Botulinum neurotoxin A light-chain
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botA, atx, bna
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7B8V4 (20-End)
      • cloning artifact (10-19)
      • conflict (21)
    Domains in SCOPe 2.04: d2ilpa_
  • Chain 'B':
    Compound: Botulinum neurotoxin A light-chain
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botA, atx, bna
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7B8V4 (20-End)
      • cloning artifact (10-19)
      • conflict (21)
    Domains in SCOPe 2.04: d2ilpb_
  • Heterogens: ZN, PO4, GB5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ilpA (A:)
    mgsshhhhhhssglvprgshmqfvnkqfnykdpvngvdiayikipnvgqmqpvkafkihn
    kiwviperdtftnpeegdlnpppeakqvpvsyydstylstdnekdnylkgvtklferiys
    tdlgrmlltsivrgipfwggstidtelkvidtncinviqpdgsyrseelnlviigpsadi
    iqfecksfghevlnltrngygstqyirfspdftfgfeeslevdtnpllgagkfatdpavt
    lahelihaghrlygiainpnrvfkvntnayyemsglevsfeelrtfgghdakfidslqen
    efrlyyynkfkdiastlnkaksivgttaslqymknvfkekyllsedtsgkfsvdklkfdk
    lykmlteiytednfvkffkvlnrktylnfdkavfkinivpkvnytiydgfnlrntnlaan
    fngqnteinnmnftklknftglfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ilpA (A:)
    ssglvprgshmqfvnkqfnykdpvngvdiayikipqmqpvkafkihnkiwviperdtftn
    peegdlnppvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfw
    ggstidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrn
    gygstqyirfspdftfgfeeslevnpllgagkfatdpavtlahelihaghrlygiainpn
    rvfkevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkaksivgttaslqy
    mknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvlnrktylnfdka
    vfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ilpB (B:)
    mgsshhhhhhssglvprgshmqfvnkqfnykdpvngvdiayikipnvgqmqpvkafkihn
    kiwviperdtftnpeegdlnpppeakqvpvsyydstylstdnekdnylkgvtklferiys
    tdlgrmlltsivrgipfwggstidtelkvidtncinviqpdgsyrseelnlviigpsadi
    iqfecksfghevlnltrngygstqyirfspdftfgfeeslevdtnpllgagkfatdpavt
    lahelihaghrlygiainpnrvfkvntnayyemsglevsfeelrtfgghdakfidslqen
    efrlyyynkfkdiastlnkaksivgttaslqymknvfkekyllsedtsgkfsvdklkfdk
    lykmlteiytednfvkffkvlnrktylnfdkavfkinivpkvnytiydgfnlrntnlaan
    fngqnteinnmnftklknftglfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ilpB (B:)
    ssglvprgshmqfvnkqfnykdpvngvdiayikipgqmqpvkafkihnkiwviperdtft
    npeegdlnpppvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfw
    ggstidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrn
    gygstqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiain
    pnrvflevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkaksivgttasl
    qymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvlnrktylnfd
    kavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklk