PDB entry 2ilm

View 2ilm on RCSB PDB site
Description: Factor Inhibiting HIF-1 Alpha D201A Mutant in Complex with FE(II), Alpha-Ketoglutarate and HIF-1 Alpha 35mer
Class: transcription regulator, oxidoreductase
Keywords: fih, hif, dsbh, oxygenase, transcription, hypoxia, inhibitor 2-oxoglutarate, asparaginyl hydroxylase,, transcription regulator, oxidoreductase
Deposited on 2006-10-03, released 2007-08-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.209
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxia-inducible factor 1 alpha inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: HIF1AN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NWT6 (Start-348)
      • engineered (200)
    Domains in SCOPe 2.06: d2ilma_
  • Chain 'S':
    Compound: Hypoxia-inducible factor 1 alpha
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE2, SO4, BCT, AKG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ilmA (A:)
    maataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee
    pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr
    eemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwg
    qltsnllligmegnvtpahyaeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqs
    qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga
    ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ilmA (A:)
    avasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdt
    nlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhe
    fveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnll
    ligmegnvtpahyaeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnp
    dyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkiey
    plkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

  • Chain 'S':
    No sequence available.