PDB entry 2ill

View 2ill on RCSB PDB site
Description: Anomalous substructure of Titin-A168169
Class: transferase
Keywords: long wavelength, TRANSFERASE
Deposited on 2006-10-03, released 2007-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WZ42 (1-194)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d2illa1, d2illa2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2illA (A:)
    maphfkeelrnlnvryqsnatlvckvtghpkpivkwyrqgkeiiadglkyriqefkggyh
    qliiasvtdddatvyqvratnqggsvsgtaslevevpakihlpktlegmgavhalrgevv
    sikipfsgkpdpvitwqkgqdlidnnghyqvivtrsftslvfpngverkdagfyvvcakn
    rfgidqktveldvad