PDB entry 2il5

View 2il5 on RCSB PDB site
Description: Structure of Protein of Unknown Function SA2116 from Staphylococcus aureus
Class: structural genomics, unknown function
Keywords: structural genomics, APC23650, hypothetical protein, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2006-10-02, released 2006-10-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Staphylococcus aureus subsp. aureus [TaxId:367830]
    Gene: SA2116
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2FEH1 (Start-170)
      • modified residue (43)
      • modified residue (85)
      • modified residue (91)
      • modified residue (95)
      • modified residue (119)
      • modified residue (149)
      • modified residue (156)
      • modified residue (160)
    Domains in SCOPe 2.02: d2il5a1
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2il5A (A:)
    snamakfnvenehveveieklykfspelvyeawtkkdllkqwfmtsartnkeieadvkeg
    gkyrivdqqrngkvnviegiyeslvmdeyvkmtigmpglsetqdvievefferetggtqm
    lfyyrslvekerrftnleykqkkkeyhdamvhgfelmfdkmyhvietstqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2il5A (A:)
    nvenehveveieklykfspelvyeawtkkdllkqwfmtsartnkeieadvkeggkyrivd
    qqrngkvnviegiyeslvmdeyvkmtigmpsetqdvievefferetggtqmlfyyrslve
    kerrftnleykqkkkeyhdamvhgfelmfdkmyhvietstqq