PDB entry 2iiy

View 2iiy on RCSB PDB site
Description: Crystal structure of S-nitroso thioredoxin
Class: oxidoreductase
Keywords: S-nitrosation, S-nitrosocysteine, OXIDOREDUCTASE
Deposited on 2006-09-28, released 2006-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.21
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: TXN, TRDX, TRX, TRX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (0-104)
      • modified residue (61)
      • modified residue (68)
    Domains in SCOPe 2.07: d2iiya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iiyA (A:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv