PDB entry 2ii0

View 2ii0 on RCSB PDB site
Description: Crystal Structure of catalytic domain of Son of sevenless (Rem-Cdc25) in the absence of Ras
Class: signaling protein
Keywords: signaling protein
Deposited on 2006-09-27, released 2006-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.218
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Son of sevenless homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SOS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ii0a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ii0A (A:)
    gamaeeqmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmya
    dpnfvrtflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrk
    eyiqpvqlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqr
    kkiardngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyrav
    qpselvgsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieil
    qvfqelnnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylakl
    rsinppcvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpy
    clrvesdikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspg
    vrpsnprpgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ii0A (A:)
    qmrlpsadvyrfaepdseeniifegipiikagtviklierltyhmyadpnfvrtflttyr
    sfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlrvlnv
    crhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiafqsspptve
    whisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkeinspnll
    kmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsamnssp
    vyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltnilktee
    gnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmgnsme
    keftdylfnksleieprnpkplprfpkkysyplkspgvrpsnp