PDB entry 2ihl

View 2ihl on RCSB PDB site
Description: lysozyme (e.c.3.2.1.17) (japanese quail)
Deposited on 1993-06-29, released 1994-01-31
The last revision prior to the SCOP 1.61 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.4 Å
R-factor: 0.165
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d2ihl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ihl_ (-)
kvygrcelaaamkrhgldkyqgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdvhgmnawvawrnrckgtdv
nawirgcrl