PDB entry 2igd

View 2igd on RCSB PDB site
Description: anisotropic structure of protein g igg-binding domain iii at 1.1 angstrom resolution
Deposited on 1997-04-30, released 1998-07-29
The last revision prior to the SCOP 1.65 freeze date was dated 1998-07-29, with a file datestamp of 1998-07-29.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.097
AEROSPACI score: 0.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d2igd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2igd_ (-)
    mtpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvt
    e