PDB entry 2ifq

View 2ifq on RCSB PDB site
Description: Crystal structure of S-nitroso thioredoxin
Class: oxidoreductase
Keywords: S-nitrosocysteine, phoroteduction, OXIDOREDUCTASE
Deposited on 2006-09-21, released 2006-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.179
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: TXN, TRDX, TRX, TRX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (0-104)
      • modified residue (68)
    Domains in SCOPe 2.07: d2ifqa_
  • Chain 'B':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: TXN, TRDX, TRX, TRX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ifqb_
  • Chain 'C':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: TXN, TRDX, TRX, TRX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10599 (0-104)
      • modified residue (68)
    Domains in SCOPe 2.07: d2ifqc_
  • Heterogens: EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ifqA (A:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ifqB (B:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ifqC (C:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv