PDB entry 2ifm

View 2ifm on RCSB PDB site
Description: pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 angstroms resolution x-ray fibre diffraction data
Class: Virus
Keywords: VIRUS COAT PROTEIN, Helical virus
Deposited on 1995-01-16, released 1996-01-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: FIBER
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pf1 filamentous bacteriophage
    Species: Xanthomonas phage Xf [TaxId:356629]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ifma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ifmA (A:)
    gvidtsavesaitdgqgdmkaiggyivgalvilavagliysmlrka