PDB entry 2ifg

View 2ifg on RCSB PDB site
Description: Structure of the extracellular segment of human TRKA in complex with nerve growth factor
Class: transferase
Keywords: trk, trka, ngf, nerve growth factor, receptor-ligand complex, transferase
Deposited on 2006-09-20, released 2007-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.297
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high affinity nerve growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NTRK1, TRK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ifga1, d2ifga2, d2ifga3
  • Chain 'B':
    Compound: high affinity nerve growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NTRK1, TRK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ifgb1, d2ifgb2, d2ifgb3
  • Chain 'E':
    Compound: Beta-nerve growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: NGFB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ifge1
  • Chain 'F':
    Compound: Beta-nerve growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: NGFB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ifgf1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ifgA (A:)
    cpdaccphgssglrctrdgaldslhhlpgaenltelyienqqhlqhlelrdlrglgelrn
    ltivksglrfvapdafhftprlsrlnlsfnaleslswktvqglslqelvlsgnplhcsca
    lrwlqrweeeglggvpeqklqchgqgplahmpnascgvptlkvqvpnasvdvgddvllrc
    qvegrgleqagwilteleqsatvmksgglpslgltlanvtsdlnrknvtcwaendvgrae
    vsvqvnvsfpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflep
    aanetvrhgclrlnqpthvnngnytllaanpfgqasasimaafmdnp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ifgB (B:)
    cpdaccphgssglrctrdgaldslhhlpgaenltelyienqqhlqhlelrdlrglgelrn
    ltivksglrfvapdafhftprlsrlnlsfnaleslswktvqglslqelvlsgnplhcsca
    lrwlqrweeeglggvpeqklqchgqgplahmpnascgvptlkvqvpnasvdvgddvllrc
    qvegrgleqagwilteleqsatvmksgglpslgltlanvtsdlnrknvtcwaendvgrae
    vsvqvnvsfpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflep
    aanetvrhgclrlnqpthvnngnytllaanpfgqasasimaafmdnp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ifgE (E:)
    ssshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrd
    pnpvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrkavrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ifgE (E:)
    sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdg
    crgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ifgF (F:)
    ssshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrd
    pnpvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrkavrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ifgF (F:)
    sshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdg
    crgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka