PDB entry 2ife

View 2ife on RCSB PDB site
Description: translation initiation factor if3 from escherichia coli ribosome binding domain (residues 84-180)
Class: gene regulation
Keywords: initiation factor, gene regulation
Deposited on 1998-12-16, released 1998-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (translation initiation factor if3)
    Species: Escherichia coli [TaxId:562]
    Gene: INFC CODONS 84-180
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ifea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ifeA (A:)
    mefqkkkqkviqvkeikfrpgtdegdyqvklrslirfleegdkakitlrfrgremahqqi
    gmevlnrvkddlqelavvesfptkiegrqmimvlapkkkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ifeA (A:)
    viqvkeikfrpgtdegdyqvklrslirfleegdkakitlrfrgremahqqigmevlnrvk
    ddlqelavvesfptkiegrqmimvlapkkkq