PDB entry 2if0

View 2if0 on RCSB PDB site
Description: Crystal Structure of mouse Rab27b bound to GDP in monoclinic space group
Class: signaling protein
Keywords: Rab27, GTPase, Rab, signaling protein, GDP, swapping
Deposited on 2006-09-19, released 2007-05-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.262
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-27B
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99P58
      • engineered mutation (79)
    Domains in SCOPe 2.03: d2if0a_
  • Chain 'B':
    Compound: Ras-related protein Rab-27B
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99P58
      • engineered mutation (79)
    Domains in SCOPe 2.03: d2if0b_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2if0A (A:)
    gsmtdgdydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvydtqga
    dgasgkafkvhlqlwdtaglerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlq
    anaycenpdivlignkadlpdqrevnerqarelaekygipyfetsaatgqnveksvetll
    dlimkrmekcvektqvpdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2if0A (A:)
    ydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvydafkvhlqlwdt
    aglerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanaycenpdivlignka
    dlpdqrevnerqarelaekygipyfetsaatgqnveksvetlldlimkrmekcv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2if0B (B:)
    gsmtdgdydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvydtqga
    dgasgkafkvhlqlwdtaglerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlq
    anaycenpdivlignkadlpdqrevnerqarelaekygipyfetsaatgqnveksvetll
    dlimkrmekcvektqvpdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2if0B (B:)
    ydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvydafkvhlqlwdt
    aglerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanaycenpdivlignka
    dlpdqrevnerqarelaekygipyfetsaatgqnveksvetlldlimkrmekcve