PDB entry 2id1

View 2id1 on RCSB PDB site
Description: X-Ray Crystal Structure of Protein CV0518 from Chromobacterium violaceum, Northeast Structural Genomics Consortium Target CvR5.
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-09-13, released 2006-09-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.228
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Chromobacterium violaceum [TaxId:243365]
    Gene: CV_0518
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7P0P8 (0-End)
      • modified residue (0)
      • modified residue (36)
      • modified residue (89)
    Domains in SCOPe 2.04: d2id1a1
  • Chain 'B':
    Compound: hypothetical protein
    Species: Chromobacterium violaceum [TaxId:243365]
    Gene: CV_0518
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7P0P8 (0-End)
      • modified residue (0)
      • modified residue (36)
      • modified residue (89)
    Domains in SCOPe 2.04: d2id1b_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2id1A (A:)
    meiqeisklaiealedikgkdiieldtskltslfqrmivatgdsnrqvkalansvqvklk
    eagvdivgseghesgewvlvdagdvvvhvmlpavrdyydiealwggqkpsfavgaakpws
    avlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2id1A (A:)
    meiqeisklaiealedikgkdiieldtskltslfqrmivatgdsnrqvkalansvqvklk
    eagvdivgseghesgewvlvdagdvvvhvmlpavrdyydiealwggqkpsfavgaakpws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2id1B (B:)
    meiqeisklaiealedikgkdiieldtskltslfqrmivatgdsnrqvkalansvqvklk
    eagvdivgseghesgewvlvdagdvvvhvmlpavrdyydiealwggqkpsfavgaakpws
    avlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2id1B (B:)
    meiqeisklaiealedikgkdiieldtskltslfqrmivatgdsnrqvkalansvqvklk
    eagvdivgseghesgewvlvdagdvvvhvmlpavrdyydiealwggqkpsfavgaakpws