PDB entry 2ict

View 2ict on RCSB PDB site
Description: Crystal structure of the bacterial antitoxin HigA from Escherichia coli at pH 8.5. Northeast Structural Genomics TARGET ER390.
Class: DNA binding protein
Keywords: helix-turn-helix, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2006-09-13, released 2006-09-26
The last revision prior to the SCOP 1.75 freeze date was dated 2006-09-26, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.198
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antitoxin higa
    Species: Escherichia coli
    Gene: higa
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2icta1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ictA (A:)
mkmanhprpgdiiqesldelnvslrefarameiapstasrlltgkaaltpemaiklsvvi
gsspqmwlnlqnawslaeaektvdvsrlrrlvtq