PDB entry 2ica

View 2ica on RCSB PDB site
Description: CD11a (LFA1) I-domain complexed with BMS-587101 aka 5-[(5S, 9R)-9-(4-cyanophenyl)-3-(3,5-dichlorophenyl)-1-methyl-2,4-dioxo-1,3,7-triazaspiro [4.4]non-7-yl]methyl]-3-thiophenecarboxylicacid
Class: cell adhesion
Keywords: inhibitor,protein/ligand complex, cell adhesion
Deposited on 2006-09-12, released 2006-12-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.192
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAL, CD11A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (4-End)
      • cloning artifact (3)
    Domains in SCOPe 2.03: d2icaa_
  • Heterogens: 2IC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2icaA (A:)
    gshmnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfs
    dyvkrkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatd
    sgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqk
    kiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2icaA (A:)
    mnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkki