PDB entry 2ic7

View 2ic7 on RCSB PDB site
Description: Crystal Structure of Maltose Transacetylase from Geobacillus kaustophilus
Class: transferase
Keywords: STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, SOUTHEAST COLLABORATORY FOR STRUCTURAL GENOMICS, SECSG, RIKEN GENOMICS SCIENCES CENTER, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2006-09-12, released 2006-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maltose transacetylase
    Species: Geobacillus kaustophilus [TaxId:1462]
    Gene: GKB08
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ic7a_
  • Chain 'B':
    Compound: Maltose transacetylase
    Species: Geobacillus kaustophilus [TaxId:1462]
    Gene: GKB08
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ic7b_
  • Chain 'C':
    Compound: Maltose transacetylase
    Species: Geobacillus kaustophilus [TaxId:1462]
    Gene: GKB08
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ic7c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ic7A (A:)
    mksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstger
    lfiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldphe
    rnsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakv
    ikwlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ic7B (B:)
    mksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstger
    lfiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldphe
    rnsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakv
    ikwlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ic7C (C:)
    mksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstger
    lfiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldphe
    rnsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakv
    ikwlk