PDB entry 2ic5

View 2ic5 on RCSB PDB site
Description: Crystal structure of human RAC3 grown in the presence of Gpp(NH)p.
Class: signaling protein
Keywords: GTPase RAC3, small GTP binding protein, p21 rac, ras-related C3 botulinum toxin substrate 3, signalling protein, GppNHp, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2006-09-12, released 2006-10-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.155
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related c3 botulinum toxin substrate 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60763 (1-178)
      • cloning artifact (0)
      • engineered (178)
    Domains in SCOPe 2.06: d2ic5a1, d2ic5a2
  • Chain 'B':
    Compound: ras-related c3 botulinum toxin substrate 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60763 (1-178)
      • engineered (178)
    Domains in SCOPe 2.06: d2ic5b_
  • Heterogens: MG, CL, GNP, GDP, BTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ic5A (A:)
    smqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdta
    gqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldl
    rddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ic5A (A:)
    smqaikcvvvgdgavgktcllisyttnafpgeyipfdnysanvmvdgkpvnlglwdtagq
    edydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlrd
    dkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ic5B (B:)
    smqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdta
    gqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldl
    rddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ic5B (B:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlr
    ddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavlg