PDB entry 2ic2

View 2ic2 on RCSB PDB site
Description: Crystal Structure of the First FNIII Domain of Ihog
Class: protein binding
Keywords: ihog, hedgehog, fibronectin type III, PROTEIN BINDING
Deposited on 2006-09-12, released 2006-10-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.215
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cg9211-pa
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: iHog, CG9211
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2XY56 (3-End)
      • cloning artifact (0-2)
      • modified residue (19)
      • modified residue (23)
      • modified residue (41)
    Domains in SCOPe 2.04: d2ic2a1
  • Chain 'B':
    Compound: cg9211-pa
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: iHog, CG9211
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2XY56 (3-114)
      • cloning artifact (1-2)
      • modified residue (19)
      • modified residue (23)
      • modified residue (41)
    Domains in SCOPe 2.04: d2ic2b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ic2A (A:)
gstypptppnvtrlsdesvmlrwmvprndglpivifkvqyrmvgkrknwqttndnipygk
pkwnselgksftasvtdlkpqhtyrfrilavysnndnkesntsakfylqpgaald

    Sequence, based on observed residues (ATOM records): (download) 
    >2ic2A (A:)
gstypptppnvtrlsvmlrwmvprndglpivifkvqyrmvgnwqttndnipygkpkwnse
lgksftasvtdlkpqhtyrfrilavysnndnkesntsakfylqp

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2ic2B (B:)
gstypptppnvtrlsdesvmlrwmvprndglpivifkvqyrmvgkrknwqttndnipygk
pkwnselgksftasvtdlkpqhtyrfrilavysnndnkesntsakfylqpgaald

    Sequence, based on observed residues (ATOM records): (download) 
    >2ic2B (B:)
stypptppnvtrlsdesvmlrwmvprndglpivifkvqyrmvgkrknwqttndnipygkp
kwnselgksftasvtdlkpqhtyrfrilavysnndnkesntsakfylqpgaald