PDB entry 2ibl

View 2ibl on RCSB PDB site
Description: Crystal structure of a helper molecule (HT-mf-thromb) based on mini-fibritin (mf) crystal structure (pdb:1OX3).
Class: chaperone
Keywords: mini-fibritin, foldon, trimerization, bacteriophage t4, helper molecule, CHAPERONE
Deposited on 2006-09-11, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibritin
    Species: Enterobacteria phage Ox2 [TaxId:10691]
    Gene: WAC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ibla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iblA (A:)
    mghhhhhhgsgtdivlndlpfvdgppaegqsriswikngeeilgadtqygsegsmnrptv
    svlrnvevldknigilktsletansdiktiqeagyipeaprdgqayvrkdgewvllstfl
    gssgsglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iblA (A:)
    divlndlpfvdgppaegqsriswikngeeilgadtqygsegsmnrptvsvlrnvevldkn
    igilktsletansdiktiqeagyipeaprdgqayvrkdgewvllstfl