PDB entry 2iad

View 2iad on RCSB PDB site
Description: class II MHC I-ad in complex with an influenza hemagglutinin peptide 126-138
Class: MHC II
Keywords: MHC II, class II MHC I-ad
Deposited on 1998-03-13, released 1998-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.253
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II I-ad
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2iada1, d2iada2, d2iada3
  • Chain 'B':
    Compound: MHC class II I-ad
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2iadb1, d2iadb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iadA (A:)
    eddieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfep
    qgglqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppv
    initwlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlk
    hwepeissadlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iadA (A:)
    ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg
    lqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlkhws
    sadlvpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iadB (B:)
    ghatqgvtaasshegnserhfvvqfkgecyytngtqrirlvtryiynreeyvrydsdvge
    yravtelgrpdaeywnsqpeilertraevdtacrhnyegpetstslrrleqpnvaislsr
    tealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtp
    hqgevytchvehpslkspitvewss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iadB (B:)
    ghatqgvtaassherhfvvqfkgecyytngtqrirlvtryiynreeyvrydsdvgeyrav
    telgrpdaeywnsqpeilertraevdtacrhnyegpetstslrrleqpnvaislsrteal
    nhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtphqge
    vytchvehpslkspitvewss