PDB entry 2i7f

View 2i7f on RCSB PDB site
Description: Sphingomonas yanoikuyae B1 ferredoxin
Class: oxidoreductase
Keywords: rieske ferredoxin, oxidoreductase
Deposited on 2006-08-30, released 2007-03-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin component of dioxygenase
    Species: Sphingobium yanoikuyae [TaxId:13690]
    Gene: ahdA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2i7fa_
  • Chain 'B':
    Compound: Ferredoxin component of dioxygenase
    Species: Sphingobium yanoikuyae [TaxId:13690]
    Gene: ahdA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2i7fb_
  • Heterogens: SO4, FES, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i7fA (A:)
    msnklrlcqvasvkdgepvavyqekmpalavynvdgevfvtdnlcthgnamltdgyqdgt
    iiecpfhggsfdiatgaakafpcqipiktypvtiedgwvcidqpkesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i7fA (A:)
    nklrlcqvasvkdgepvavyqekmpalavynvdgevfvtdnlcthgnamltdgyqdgtii
    ecpfhggsfdiatgaakafpcqipiktypvtiedgwvcidqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i7fB (B:)
    msnklrlcqvasvkdgepvavyqekmpalavynvdgevfvtdnlcthgnamltdgyqdgt
    iiecpfhggsfdiatgaakafpcqipiktypvtiedgwvcidqpkesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i7fB (B:)
    nklrlcqvasvkdgepvavyqekmpalavynvdgevfvtdnlcthgnamltdgyqdgtii
    ecpfhggsfdiatgaakafpcqipiktypvtiedgwvcidqp