PDB entry 2i7b

View 2i7b on RCSB PDB site
Description: Structure of the naturally occuring mutant of human ABO(H) Blood group B glycosyltransferase: GTB/A268T
Class: transferase
Keywords: glycosyltransferase, blood group, ABO allele, hybrid allele, TRANSFERASE
Deposited on 2006-08-30, released 2007-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.187
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha 1-3-galactosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: ABO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6ISD4 (1-End)
      • variant (205)
    Domains in SCOPe 2.07: d2i7ba_
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i7bA (A:)
    mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
    ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrwq
    dvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssre
    aftyerrpqsqayipkdegdfyymgtffggsvqevqrltrachqammvdqangieavwhd
    eshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i7bA (A:)
    vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
    kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevcerrflse
    vdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrpqsqayipkdegdf
    yymgtffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvlspey
    lwdqqllgwpavlrklrftavp