PDB entry 2i69

View 2i69 on RCSB PDB site
Description: Crystal structure of the West Nile virus envelope glycoprotein
Class: viral protein
Keywords: Viral membrane fusion protein, receptor binding, antibody epitope, IgC, beta sandwich, glycoprotein, VIRAL PROTEIN
Deposited on 2006-08-28, released 2006-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.11 Å
R-factor: 0.209
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyprotein
    Species: West Nile virus [TaxId:11082]
    Gene: Envelope protein
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i69a1, d2i69a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i69A (A:)
    fnclgmsnrdflegvsgatwvdlvlegdscvtimskdkptidvkmmnmeaanlaevrsyc
    ylatvsdlstkaacptmgeahndkradpafvcrqgvvdrgwgngcglfgkgsidtcakfa
    cstkaigrtilkenikyevaifvhgpttveshgnystqvgatqagrfsitpaapsytlkl
    geygevtvdceprsgidtnayyvmtvgtktflvhrewfmdlnlpwssagstvwrnretlm
    efeephatkqsvialgsqegalhqalagaipvefssntvkltsghlkcrvkmeklqlkgt
    tygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvgrlvtvnp
    fvsvatanakvlieleppfgdsyivvgrgeqqinhhwhksgss