PDB entry 2i4s

View 2i4s on RCSB PDB site
Description: PDZ domain of EpsC from Vibrio cholerae, residues 204-305
Class: protein transport, membrane protein
Keywords: EpsC, GspC, PDZ domain, Type 2 Secretion System, General Secretion Pathway, PROTEIN TRANSPORT, MEMBRANE PROTEIN
Deposited on 2006-08-22, released 2006-10-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.179
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: General secretion pathway protein C
  Species: Vibrio cholerae [TaxId:666]
  Gene: epsC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45777 (3-104)
    • cloning artifact (0-2)
    • modified residue (59)
    • modified residue (74)
    • modified residue (81)
    • modified residue (84)
    • modified residue (87)
  Domains in SCOPe 2.04: d2i4sa1
• Chain 'B':
  Compound: General secretion pathway protein C
  Species: Vibrio cholerae [TaxId:666]
  Gene: epsC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45777 (3-104)
    • cloning artifact (0-2)
    • modified residue (59)
    • modified residue (74)
    • modified residue (81)
    • modified residue (84)
    • modified residue (87)
  Domains in SCOPe 2.04: d2i4sb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2i4sA (A:)
  gamedkvdaireaiarnpqeifqyvrlsqvkrddkvlgyrvspgkdpvlfesiglqdgdm
  avalngldltdpnvmntlfqsmnemtemsltverdgqqhdvyiqf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2i4sB (B:)
  gamedkvdaireaiarnpqeifqyvrlsqvkrddkvlgyrvspgkdpvlfesiglqdgdm
  avalngldltdpnvmntlfqsmnemtemsltverdgqqhdvyiqf