PDB entry 2i4j

View 2i4j on RCSB PDB site
Description: Crystal structure of the complex between PPARgamma and the agonist LT160 (ureidofibrate derivative)
Class: transcription
Keywords: bundle of alpha-helices and a small four-stranded beta-sheet, TRANSCRIPTION
Deposited on 2006-08-22, released 2007-04-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.247
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2i4ja_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2i4jb_
  • Heterogens: DRJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i4jA (A:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i4jA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i4jB (B:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i4jB (B:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdl