PDB entry 2i19

View 2i19 on RCSB PDB site
Description: T. Brucei farnesyl diphosphate synthase complexed with bisphosphonate
Class: transferase
Keywords: protein-bisphosphonate complex, transferase
Deposited on 2006-08-13, released 2006-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.217
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i19a_
  • Chain 'B':
    Compound: farnesyl pyrophosphate synthase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i19b_
  • Heterogens: MG, 1BY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i19A (A:)
    mgsshhhhhhssglvprgshmasmpmqmfmqvydeiqmflleelelkfdmdpnrvrylrk
    mmdttclggkynrgltvidvaesllslspnnngeeddgarrkrvlhdacvcgwmieflqa
    hylveddimdnsvtrrgkpcwyrhpdvtvqcaindglllkswthmmamhffadrpflqdl
    lcrfnrvdyttavgqlydvtsmfdsnkldpdvsqptttdfaeftlsnykrivkyktayyt
    yllplvmglivsealptvdmgvteelamlmgeyfqvqddvmdcftpperlgkvgtdiqda
    kcswlavtflakassaqvaefkanygsgdsekvatvrrlyeeadlqgdyvayeaavaeqv
    kelieklrlcspgfaasvetlwgktykrqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i19A (A:)
    mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
    llslspnnngeeddgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyr
    hpdvtvqcaindglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmf
    dsnkldpdvsqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvt
    eelamlmgeyfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefka
    nygsgdsekvatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwg
    ktykrqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i19B (B:)
    mgsshhhhhhssglvprgshmasmpmqmfmqvydeiqmflleelelkfdmdpnrvrylrk
    mmdttclggkynrgltvidvaesllslspnnngeeddgarrkrvlhdacvcgwmieflqa
    hylveddimdnsvtrrgkpcwyrhpdvtvqcaindglllkswthmmamhffadrpflqdl
    lcrfnrvdyttavgqlydvtsmfdsnkldpdvsqptttdfaeftlsnykrivkyktayyt
    yllplvmglivsealptvdmgvteelamlmgeyfqvqddvmdcftpperlgkvgtdiqda
    kcswlavtflakassaqvaefkanygsgdsekvatvrrlyeeadlqgdyvayeaavaeqv
    kelieklrlcspgfaasvetlwgktykrqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i19B (B:)
    mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes
    llslseddgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyrhpdvtv
    qcaindglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmfdsnkld
    pdvsqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvteelaml
    mgeyfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefkanygsgd
    sekvatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwgktykrq
    k