PDB entry 2hzy

View 2hzy on RCSB PDB site
Description: Mouse fumarylacetoacetate hydrolase complexes with a transition-state mimic of the complete substrate
Class: hydrolase
Keywords: transition-state mimicking complex, HYDROLASE
Deposited on 2006-08-09, released 2006-08-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.169
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fumarylacetoacetase
    Species: Mus musculus [TaxId:10090]
    Gene: Fah
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hzya1, d2hzya2
  • Chain 'B':
    Compound: Fumarylacetoacetase
    Species: Mus musculus [TaxId:10090]
    Gene: Fah
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35505 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d2hzyb1, d2hzyb2, d2hzyb3
  • Heterogens: NA, MN, NI, CA, DHJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hzyA (A:)
    gsmsfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskh
    qhvfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp
    atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
    qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
    iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
    lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
    fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpalsp
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hzyA (A:)
    msfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskhqh
    vfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlpat
    igdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmgqm
    rpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsardiq
    qweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdinls
    vslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpesfg
    smlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hzyB (B:)
    gsmsfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskh
    qhvfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp
    atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
    qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
    iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
    lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
    fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpalsp
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hzyB (B:)
    gsmsfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskh
    qhvfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp
    atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
    qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
    iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
    lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
    fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpal