PDB entry 2hzt

View 2hzt on RCSB PDB site
Description: Crystal Structure of a putative HTH-type transcriptional regulator ytcD
Class: transcription regulator
Keywords: DNA-binding protein, HTH-type transcription regulators, Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSCRIPTION REGULATOR
Deposited on 2006-08-09, released 2006-08-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.236
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative HTH-type transcriptional regulator ytcD
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34533 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.04: d2hzta1
  • Chain 'B':
    Compound: Putative HTH-type transcriptional regulator ytcD
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34533 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.04: d2hztb_
  • Chain 'C':
    Compound: Putative HTH-type transcriptional regulator ytcD
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34533 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.04: d2hztc_
  • Chain 'D':
    Compound: Putative HTH-type transcriptional regulator ytcD
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34533 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.04: d2hztd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hztA (A:)
    mslveatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinr
    ivynqvppkveyelseygrslegildmlcawganhinrveghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hztA (A:)
    mslveatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinr
    ivynqvppkveyelseygrslegildmlcawganhinr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hztB (B:)
    mslveatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinr
    ivynqvppkveyelseygrslegildmlcawganhinrveghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hztB (B:)
    mslveatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinr
    ivynqvppkveyelseygrslegildmlcawganhinr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hztC (C:)
    mslveatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinr
    ivynqvppkveyelseygrslegildmlcawganhinrveghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hztC (C:)
    mslveatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinr
    ivynqkveyelseygrslegildmlcawganhinr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hztD (D:)
    mslveatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinr
    ivynqvppkveyelseygrslegildmlcawganhinrveghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hztD (D:)
    mslveatleviggkwkcvilchlthgkkrtselkrlmpnitqkmltqqlreleadgvinr
    ivynqkveyelseygrslegildmlcawganhinr