PDB entry 2hzn

View 2hzn on RCSB PDB site
Description: Abl kinase domain in complex with NVP-AFG210
Class: transferase
Keywords: tyrosine kinase, TRANSFERASE
Deposited on 2006-08-09, released 2007-01-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.267
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Mus musculus [TaxId:10090]
    Gene: ABL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61258 (6-End)
      • cloning artifact (2-5)
    Domains in SCOPe 2.03: d2hzna_
  • Heterogens: KIN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hznA (A:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkrgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hznA (A:)
    mdpsspnydkwemertditmkhklgggevyegvwkkysltvavktldtmeveeflkeaav
    mkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqiss
    ameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtape
    slaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvy
    elmracwqwnpsdrpsfaeihqafetmfqessi