PDB entry 2hzi

View 2hzi on RCSB PDB site
Description: Abl kinase domain in complex with PD180970
Class: transferase
Keywords: tyrosine kinase, TRANSFERASE
Deposited on 2006-08-09, released 2007-01-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.177
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2hzia_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2hzib_
  • Heterogens: JIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hziA (A:)
    gamdpspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveef
    lkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllym
    atqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpi
    kwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpeg
    cpekvyelmracwqwnpsdrpsfaeihqafetmfqes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hziA (A:)
    dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke
    ikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissame
    ylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesla
    ynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelm
    racwqwnpsdrpsfaeihqafetmfqes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hziB (B:)
    gamdpspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveef
    lkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllym
    atqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpi
    kwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpeg
    cpekvyelmracwqwnpsdrpsfaeihqafetmfqes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hziB (B:)
    dkwemertditmkhklgggqygevyegvwkkysltvavktlmeveeflkeaavmkeikhp
    nlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameylek
    knfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkf
    siksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracw
    qwnpsdrpsfaeihqafetmfqes