PDB entry 2hzg

View 2hzg on RCSB PDB site
Description: Crystal stucture of predicted Mandelate racemase from Rhodobacter sphaeroides
Class: isomerase
Keywords: structural genomics, predicted Mandelate racemase, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ISOMERASE
Deposited on 2006-08-08, released 2006-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.152
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: RSP_3884
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3HKK5 (3-392)
      • cloning artifact (1-2)
      • cloning artifact (393)
    Domains in SCOPe 2.06: d2hzga1, d2hzga2, d2hzga3, d2hzga4
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: RSP_3884
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3HKK5 (3-End)
      • cloning artifact (1-2)
    Domains in SCOPe 2.06: d2hzgb1, d2hzgb2, d2hzgb3
  • Heterogens: NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hzgA (A:)
    mslkidavdlfylsmpevtdaadgsqdallvrvaagghigwgeceaaplpsiaafvcpks
    hgvcrpvsdsvlgqrldgpddiariaalvgynsmdllqaphmlsgiemalwdllgrrlsa
    pawallgysashgkrpyasllfgdtpqetleraraarrdgfaavkfgwgpigrgtvaada
    dqimaareglgpdgdlmvdvgqifgedveaaaarlptldaagvlwleepfdagalaahaa
    lagrgarvriaggeaahnfhmaqhlmdygrigfiqidcgrigglgpakrvadaaqargit
    yvnhtftshlalsaslqpfagleadriceypaapqqlalditgdhirpdaeglirapeap
    glglqvaasalrrylveteiriggqliyrtpqleghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hzgA (A:)
    slkidavdlfylsmpevtdaadgsqdallvrvaagghigwgeceaaplpsiaafvcpksh
    gvcrpvsdsvlgqrldgpddiariaalvgynsmdllqaphmlsgiemalwdllgrrlsap
    awallgysashgkrpyasllfgdtpqetleraraarrdgfaavkfgwgpigrgtvaadad
    qimaareglgpdgdlmvdvgqifgedveaaaarlptldaagvlwleepfdagalaahaal
    agrgarvriaggeaahnfhmaqhlmdygrigfiqidcgrigglgpakrvadaaqargity
    vnhtftshlalsaslqpfagleadriceypaapqqlalditgdhirpdaeglirapeapg
    lglqvaasalrrylveteiriggqliyrtpqle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hzgB (B:)
    mslkidavdlfylsmpevtdaadgsqdallvrvaagghigwgeceaaplpsiaafvcpks
    hgvcrpvsdsvlgqrldgpddiariaalvgynsmdllqaphmlsgiemalwdllgrrlsa
    pawallgysashgkrpyasllfgdtpqetleraraarrdgfaavkfgwgpigrgtvaada
    dqimaareglgpdgdlmvdvgqifgedveaaaarlptldaagvlwleepfdagalaahaa
    lagrgarvriaggeaahnfhmaqhlmdygrigfiqidcgrigglgpakrvadaaqargit
    yvnhtftshlalsaslqpfagleadriceypaapqqlalditgdhirpdaeglirapeap
    glglqvaasalrrylveteiriggqliyrtpqleghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hzgB (B:)
    slkidavdlfylsmpevtdaadgsqdallvrvaagghigwgeceaaplpsiaafvcpksh
    gvcrpvsdsvlgqrldgpddiariaalvgynsmdllqaphmlsgiemalwdllgrrlsap
    awallgysashgkrpyasllfgdtpqetleraraarrdgfaavkfgwgpigrgtvaadad
    qimaareglgpdgdlmvdvgqifgedveaaaarlptldaagvlwleepfdagalaahaal
    agrgarvriaggeaahnfhmaqhlmdygrigfiqidcgrigglgpakrvadaaqargity
    vnhtftshlalsaslqpfagleadriceypaapqqlalditgdhirpdaeglirapeapg
    lglqvaasalrrylveteiriggqliyrtpq