PDB entry 2hzc

View 2hzc on RCSB PDB site
Description: Crystal structure of the N-terminal RRM of the U2AF large subunit
Class: RNA binding protein
Keywords: RNA splicing, RRM, RNA recognition, alternative conformation, RNA BINDING PROTEIN
Deposited on 2006-08-08, released 2006-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.137
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: splicing factor u2af 65 kda subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: U2AF2, U2AF65
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26368 (5-86)
      • cloning artifact (0-4)
    Domains in SCOPe 2.06: d2hzca1, d2hzca2
  • Heterogens: ZN, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hzcA (A:)
    gplgsarrlyvgnipfgiteeammdffnaqmrlggltqapgnpvlavqinqdknfaflef
    rsvdettqamafdgiifqgqslkirrp