PDB entry 2hz4

View 2hz4 on RCSB PDB site
Description: Abl kinase domain unligated and in complex with tetrahydrostaurosporine
Class: Transferase
Keywords: Tyrosine kinase, Transferase
Deposited on 2006-08-08, released 2007-01-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2hz4a_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2hz4b_
  • Chain 'C':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2hz4c_
  • Heterogens: 4ST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hz4A (A:)
    vspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hz4A (A:)
    kwemertditmkhklgevyegvwkkysltvavktlkedtmeveeflkeaavmkeikhpnl
    vqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameylekkn
    fihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsi
    ksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqw
    npsdrpsfaeihqafetmfqes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hz4B (B:)
    vspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hz4B (B:)
    dkwemertditmkhklgevyegvwkkysltvavktlkedtmeveeflkeaavmkeikhpn
    lvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameylekk
    nfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfs
    iksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwq
    wnpsdrpsfaeihqafetmfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hz4C (C:)
    vspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
    avmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqi
    ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
    peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
    vyelmracwqwnpsdrpsfaeihqafetmfqes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hz4C (C:)
    kwemertditmkhklgevyegvwkkytvavktlkdtmeveeflkeaavmkeikhpnlvql
    lgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameylekknfih
    rdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiksd
    vwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnps
    drpsfaeihqafetmfqes