PDB entry 2hz1

View 2hz1 on RCSB PDB site
Description: The x-ray crystal structure of ferrous Synechocystis hemoglobin with a covalent linkage
Class: oxygen storage/transport
Keywords: Synechocystis, hemoglobin, heme, globin, ferrous, hexacoordinate, covalent heme vinyl link, OXYGEN STORAGE-TRANSPORT COMPLEX
Deposited on 2006-08-08, released 2006-08-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.191
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cyanoglobin
  Species: Synechocystis sp. [TaxId:1148]
  Gene: glbN
  Database cross-references and differences (RAF-indexed):
  • Uniprot P73925 (0-122)
  Domains in SCOPe 2.03: d2hz1a_
• Heterogens: CD, SO3, HEM, SO2, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hz1A (A:)
  stlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdky
  dgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapahkrdv
  lnq