PDB entry 2hy4

View 2hy4 on RCSB PDB site
Description: Crystal Structure of Rab28 GTPase in the Active (GppNHp-bound) Form
Class: signaling protein
Keywords: Ras, Rab, GTPase, SIGNALING PROTEIN
Deposited on 2006-08-04, released 2007-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-08-26, with a file datestamp of 2008-08-22.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.198
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-28
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB28
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51157 (4-End)
      • cloning artifact (0-3)
    Domains in SCOPe 2.06: d2hy4a1, d2hy4a2
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2hy4A (A:)
gshmrqlkivvlgdgasgktslttcfaqetfgkqykqtigldfflrritlpgnlnvtlqi
wdiggqtiggkmldkyiygaqgvllvyditnyqsfenledwytvvkkvseesetqplval
vgnkidlehmrtikpekhlrfcqengfsshfvsaktgdsvflcfqkvaaeilgiklnk

    Sequence, based on observed residues (ATOM records): (download) 
    >2hy4A (A:)
gshmrqlkivvlgdgasgktslttcfaqetfgkqykqtigldfflrritlpgnlnvtlqi
wdiggqtiggkmldkyiygaqgvllvyditnyqsfenledwytvvkkvseesetqplval
vgnkidlehmrtikpekhlrfcqengfsshfvsaktgdsvflcfqkvaaeilgikln