PDB entry 2hxs

View 2hxs on RCSB PDB site
Description: Crystal Structure of Rab28A GTPase in the Inactive (GDP-3'P-Bound) Form
Class: signaling protein
Keywords: GTPase, Ras, Rab, SIGNALING PROTEIN
Deposited on 2006-08-03, released 2007-08-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.152
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ras-related protein Rab-28
  Species: Homo sapiens [TaxId:9606]
  Gene: RAB28
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51157 (4-177)
    • cloning artifact (0-3)
  Domains in SCOPe 2.04: d2hxsa_
• Heterogens: MG, G3D, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hxsA (A:)
  gshmrqlkivvlgdgasgktslttcfaqetfgkqykqtigldfflrritlpgnlnvtlqi
  wdiggqtiggkmldkyiygaqgvllvyditnyqsfenledwytvvkkvseesetqplval
  vgnkidlehmrtikpekhlrfcqengfsshfvsaktgdsvflcfqkvaaeilgiklnk