PDB entry 2hxk

View 2hxk on RCSB PDB site
Description: Crystal structure of S-nitroso thioredoxin
Class: oxidoreductase
Keywords: S-nitrosation, S-nitrosocysteine, OXIDOREDUCTASE
Deposited on 2006-08-03, released 2006-12-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.197
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: TXN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5T937 (0-104)
      • modified residue (61)
      • modified residue (68)
    Domains in SCOPe 2.06: d2hxka_
  • Chain 'B':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: TXN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5T937 (0-104)
      • modified residue (61)
      • modified residue (68)
    Domains in SCOPe 2.06: d2hxkb_
  • Chain 'C':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: TXN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5T937 (0-104)
      • modified residue (61)
      • modified residue (68)
    Domains in SCOPe 2.06: d2hxkc_
  • Heterogens: EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hxkA (A:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hxkB (B:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hxkC (C:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv