PDB entry 2hx5

View 2hx5 on RCSB PDB site
Description: Crystal structure of putative thioesterase from Prochlorococcus marinus MIT9313 at 1.50 A resolution
Class: structural genomics, unknown function
Keywords: NP_895880.1, hypothetical protein, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI
Deposited on 2006-08-02, released 2006-08-15
The last revision prior to the SCOP 1.75 freeze date was dated 2006-08-15, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.155
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Prochlorococcus marinus
    Gene: NP_895880.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7V4A7 (1-End)
      • modified residue (1)
      • modified residue (24)
      • modified residue (87)
    Domains in SCOP 1.75: d2hx5a1
  • Heterogens: ETX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hx5A (A:)
    gmnpenwlllrrvvrfgdtdaagvmhfhqlfrwchesweeslesyglnpadifpgsrkse
    vtpevalpiihcqadfrrpihtgdalamelrperlnpnsfqvhfefrceeqiaahalirh
    lainaqtrhrcalpegidrwleasgvgkigsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hx5A (A:)
    mnpenwlllrrvvrfgdtdaagvmhfhqlfrwchesweeslesyglnpadifpgsrksev
    tpevalpiihcqadfrrpihtgdalamelrperlnpnsfqvhfefrceeqiaahalirhl
    ainaqtrhrcalpegidrwleasg